Lineage for d2hgu61 (2hgu 6:1-49)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900906Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 900907Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 900908Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 900909Protein Ribosomal protein L34p [144323] (3 species)
  7. 900930Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries)
    Uniprot P80340 1-49
  8. 900941Domain d2hgu61: 2hgu 6:1-49 [145366]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    automatically matched to 2J01 7:1-49

Details for d2hgu61

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (6:) 50S ribosomal protein L34

SCOP Domain Sequences for d2hgu61:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgu61 j.118.1.1 (6:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

SCOP Domain Coordinates for d2hgu61:

Click to download the PDB-style file with coordinates for d2hgu61.
(The format of our PDB-style files is described here.)

Timeline for d2hgu61: