SCOPe 2.06: Domain d2hgu51: 2hgu 5:9-53

Lineage for d2hgu51 (2hgu 5:9-53)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
   Uniprot P35871 8-52

8. Domain d2hgu51: 2hgu 5:9-53 [145365]
   Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
   protein/RNA complex
   protein/RNA complex

Details for d2hgu51

PDB Entry: 2hgu, 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.

PDB Compounds: (5:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2hgu51:

Sequence; same for both SEQRES and ATOM records:

>d2hgu51 g.41.8.6 (5:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

Timeline for d2hgu51:

• d2hgu51 first appeared in SCOP 1.75
  
• d2hgu51 appears in SCOPe 2.05
  
• d2hgu51 appears in SCOPe 2.07
  
• d2hgu51 appears in the current release, SCOPe 2.08