Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein) Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members |
Protein Ribosomal protein L33p [144204] (3 species) |
Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries) Uniprot P35871 8-52 |
Domain d2hgu51: 2hgu 5:9-53 [145365] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 protein/RNA complex protein/RNA complex |
PDB Entry: 2hgu (more details), 4.51 Å
SCOPe Domain Sequences for d2hgu51:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgu51 g.41.8.6 (5:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]} lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
Timeline for d2hgu51:
View in 3D Domains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 |