Lineage for d2hgu41 (2hgu 4:4-60)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066475Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1066627Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 1066628Protein Ribosomal protein L32p [144201] (3 species)
  7. 1066668Species Thermus thermophilus [TaxId:274] [161177] (7 PDB entries)
    Uniprot P80339 1-59
  8. 1066675Domain d2hgu41: 2hgu 4:4-60 [145364]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    automatically matched to 2J01 5:2-60
    protein/RNA complex

Details for d2hgu41

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (4:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2hgu41:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgu41 g.41.8.5 (4:4-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
hpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2hgu41:

Click to download the PDB-style file with coordinates for d2hgu41.
(The format of our PDB-style files is described here.)

Timeline for d2hgu41: