SCOP 1.75: Domain d2hgu21: 2hgu 2:2-60

Lineage for d2hgu21 (2hgu 2:2-60)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)

8. Domain d2hgu21: 2hgu 2:2-60 [145362]
   Other proteins in same PDB: d2hgu11, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
   automatically matched to d1bxya_

Details for d2hgu21

PDB Entry: 2hgu, 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.

PDB Compounds: (2:) 50S ribosomal protein L30

SCOP Domain Sequences for d2hgu21:

Sequence; same for both SEQRES and ATOM records:

>d2hgu21 d.59.1.1 (2:2-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d2hgu21:

• d2hgu21 is new in SCOP 1.75
  
• d2hgu21 appears in SCOPe 2.01
  
• d2hgu21 appears in the current release, SCOPe 2.08