![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
![]() | Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) ![]() some topological similarity to prokaryotic ribosomal protein L17 |
![]() | Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
![]() | Protein Ribosomal protein L22 [54845] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [160267] (6 PDB entries) |
![]() | Domain d2hgqv1: 2hgq V:2-110 [145356] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqw1, d2hgqx1, d2hgqy1 automatically matched to d1bxea_ |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgqv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqv1 d.55.1.1 (V:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d2hgqv1:
![]() Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqw1, d2hgqx1, d2hgqy1 |