Lineage for d2hgqu1 (2hgq U:1-101)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967763Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 967764Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 967765Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 967766Protein Ribosomal protein L21p [141093] (3 species)
  7. 967806Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries)
    Uniprot P60492 1-101
  8. 967813Domain d2hgqu1: 2hgq U:1-101 [145355]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
    automatically matched to 2HGJ U:1-101

Details for d2hgqu1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (U:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2hgqu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqu1 b.155.1.1 (U:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOPe Domain Coordinates for d2hgqu1:

Click to download the PDB-style file with coordinates for d2hgqu1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqu1: