Lineage for d2hgqq1 (2hgq Q:14-118)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879673Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 879674Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 879675Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 879676Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 879714Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 879726Domain d2hgqq1: 2hgq Q:14-118 [145352]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
    automatically matched to d1gd8a_

Details for d2hgqq1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (Q:) 50S ribosomal protein L17

SCOP Domain Sequences for d2hgqq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqq1 d.188.1.1 (Q:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOP Domain Coordinates for d2hgqq1:

Click to download the PDB-style file with coordinates for d2hgqq1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqq1: