| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
| Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
| Protein Ribosomal protein L16p [117889] (4 species) |
| Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries) |
| Domain d2hgqp1: 2hgq P:6-141 [145351] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 automatically matched to d1wkia_ |
PDB Entry: 2hgq (more details), 5.5 Å
SCOP Domain Sequences for d2hgqp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqp1 d.41.4.2 (P:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq
Timeline for d2hgqp1:
View in 3DDomains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |