Lineage for d2hgqo1 (2hgq O:6-150)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824197Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 824198Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 824199Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 824200Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 824279Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
    Uniprot Q72I23 5-150
  8. 824287Domain d2hgqo1: 2hgq O:6-150 [145350]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
    automatically matched to 2J01 P:5-150

Details for d2hgqo1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (O:) 50S ribosomal protein L15

SCOP Domain Sequences for d2hgqo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqo1 c.12.1.1 (O:6-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
lrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpkr
gmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplkv
vahafsksaleklkaaggepvllea

SCOP Domain Coordinates for d2hgqo1:

Click to download the PDB-style file with coordinates for d2hgqo1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqo1: