Lineage for d2hgqn1 (2hgq N:1-122)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057998Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2057999Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2058000Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2058001Protein Ribosomal protein L14 [50195] (5 species)
  7. 2058084Species Thermus thermophilus [TaxId:274] [141308] (13 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 2058089Domain d2hgqn1: 2hgq N:1-122 [145349]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqn1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (N:) 50S ribosomal protein L14

SCOPe Domain Sequences for d2hgqn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqn1 b.39.1.1 (N:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOPe Domain Coordinates for d2hgqn1:

Click to download the PDB-style file with coordinates for d2hgqn1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqn1: