Lineage for d2hgqm1 (2hgq M:2-139)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463497Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2463498Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2463499Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2463500Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2463581Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 2463588Domain d2hgqm1: 2hgq M:2-139 [145348]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqm1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (M:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2hgqm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqm1 c.21.1.1 (M:2-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
vyagpdhphqaqrpekle

SCOPe Domain Coordinates for d2hgqm1:

Click to download the PDB-style file with coordinates for d2hgqm1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqm1: