SCOPe 2.06: Domain d2hgql2: 2hgq L:2-68

Lineage for d2hgql2 (2hgq L:2-68)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d2hgql2: 2hgq L:2-68 [145347]
   Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgql2

PDB Entry: 2hgq, 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.

PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2hgql2:

Sequence; same for both SEQRES and ATOM records:

>d2hgql2 d.47.1.1 (L:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

Timeline for d2hgql2:

• d2hgql2 first appeared in SCOP 1.75
  
• d2hgql2 appears in SCOPe 2.05
  
• d2hgql2 appears in SCOPe 2.07
  
• d2hgql2 appears in the current release, SCOPe 2.08