| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) ![]() automatically mapped to Pfam PF03948 |
| Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
| Protein Ribosomal protein L9 C-domain [55655] (3 species) |
| Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries) Uniprot Q5SLQ1 55-146 |
| Domain d2hgqk1: 2hgq K:56-148 [145344] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgqk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvaqe
Timeline for d2hgqk1:
View in 3DDomains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |