![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) ![]() |
![]() | Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
![]() | Protein Ribosomal protein L9 C-domain [55655] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143635] (5 PDB entries) Uniprot Q5SLQ1 55-146 |
![]() | Domain d2hgqk1: 2hgq K:56-148 [145344] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 automatically matched to 2HGJ K:56-148 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOP Domain Sequences for d2hgqk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla lekpikelgeyvltykphpevpiqlkvsvvaqe
Timeline for d2hgqk1:
![]() Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |