Lineage for d2hgqf1 (2hgq F:3-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463596Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 2463597Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 2463598Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 2463599Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 2463682Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 2463687Domain d2hgqf1: 2hgq F:3-208 [145340]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqf1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d2hgqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqf1 c.22.1.1 (F:3-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
evavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgr
kiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregk
lllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapegln
vydivrterlvmdldawevfqnrigg

SCOPe Domain Coordinates for d2hgqf1:

Click to download the PDB-style file with coordinates for d2hgqf1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqf1: