Lineage for d2hgqd1 (2hgq D:127-273)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784449Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 1784450Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 1784529Species Thermus thermophilus [TaxId:274] [159026] (6 PDB entries)
    Uniprot Q72I07 126-272
  8. 1784532Domain d2hgqd1: 2hgq D:127-273 [145337]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqd1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2hgqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqd1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
vgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelrkvh
gecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprgrpp
aspwgwqtkglktrkrrkpssrfiiar

SCOPe Domain Coordinates for d2hgqd1:

Click to download the PDB-style file with coordinates for d2hgqd1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqd1: