![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
![]() | Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) ![]() automatically mapped to Pfam PF00687 |
![]() | Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
![]() | Protein Ribosomal protein L1 [56810] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries) |
![]() | Domain d2hgqc1: 2hgq C:5-228 [145336] Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgqc1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
Timeline for d2hgqc1:
![]() Domains from other chains: (mouse over for more information) d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |