Lineage for d2hgqc1 (2hgq C:5-228)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249705Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2249706Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2249707Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2249708Protein Ribosomal protein L1 [56810] (4 species)
  7. 2249719Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 2249729Domain d2hgqc1: 2hgq C:5-228 [145336]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgqc1

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2hgqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgqc1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d2hgqc1:

Click to download the PDB-style file with coordinates for d2hgqc1.
(The format of our PDB-style files is described here.)

Timeline for d2hgqc1: