Lineage for d2hgq71 (2hgq 7:2-64)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882221Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 882222Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 882223Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 882224Protein Ribosomal protein L35p [143036] (3 species)
  7. 882264Species Thermus thermophilus [TaxId:274] [160057] (5 PDB entries)
    Uniprot P80341 1-64
  8. 882267Domain d2hgq71: 2hgq 7:2-64 [145335]
    Other proteins in same PDB: d2hgq11, d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1
    automatically matched to 2J01 8:2-65

Details for d2hgq71

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (7:) 50S ribosomal protein L35

SCOP Domain Sequences for d2hgq71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq71 d.301.1.1 (7:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
lpy

SCOP Domain Coordinates for d2hgq71:

Click to download the PDB-style file with coordinates for d2hgq71.
(The format of our PDB-style files is described here.)

Timeline for d2hgq71: