Lineage for d2hgq11 (2hgq 1:1-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979846Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1979847Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1979848Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1979932Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 1979935Domain d2hgq11: 2hgq 1:1-67 [145329]
    Other proteins in same PDB: d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1

Details for d2hgq11

PDB Entry: 2hgq (more details), 5.5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome with translocated and rotated Shine-Dalgarno Duplex. This entry 2HGQ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGP.
PDB Compounds: (1:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2hgq11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgq11 a.2.2.1 (1:1-67) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln
ekrrqna

SCOPe Domain Coordinates for d2hgq11:

Click to download the PDB-style file with coordinates for d2hgq11.
(The format of our PDB-style files is described here.)

Timeline for d2hgq11: