![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() automatically mapped to Pfam PF00831 |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries) Uniprot Q5SHP6 12-62 |
![]() | Domain d2hgq11: 2hgq 1:1-67 [145329] Other proteins in same PDB: d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |
PDB Entry: 2hgq (more details), 5.5 Å
SCOPe Domain Sequences for d2hgq11:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgq11 a.2.2.1 (1:1-67) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]} mrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarlltvln ekrrqna
Timeline for d2hgq11:
![]() Domains from other chains: (mouse over for more information) d2hgq21, d2hgq31, d2hgq41, d2hgq51, d2hgq61, d2hgq71, d2hgq81, d2hgqc1, d2hgqd1, d2hgqd2, d2hgqe1, d2hgqf1, d2hgqg1, d2hgqh1, d2hgqh2, d2hgqk1, d2hgqk2, d2hgql1, d2hgql2, d2hgqm1, d2hgqn1, d2hgqo1, d2hgqp1, d2hgqq1, d2hgqr1, d2hgqt1, d2hgqu1, d2hgqv1, d2hgqw1, d2hgqx1, d2hgqy1 |