Lineage for d2hgjw1 (2hgj W:3-95)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2536710Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2536711Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2536712Protein Ribosomal protein L23 [54191] (4 species)
  7. 2536810Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 2536815Domain d2hgjw1: 2hgj W:3-95 [145325]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjx1, d2hgjy1

Details for d2hgjw1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (W:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2hgjw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjw1 d.12.1.1 (W:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
kkrlgrylgkrpdrkkaivqvapgqkiealegl

SCOPe Domain Coordinates for d2hgjw1:

Click to download the PDB-style file with coordinates for d2hgjw1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjw1: