Lineage for d2hgjq1 (2hgj Q:14-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005595Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 3005596Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
    automatically mapped to Pfam PF01196
  5. 3005597Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 3005598Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 3005636Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 3005649Domain d2hgjq1: 2hgj Q:14-118 [145320]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjq1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (Q:) 50S ribosomal protein L17

SCOPe Domain Sequences for d2hgjq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjq1 d.188.1.1 (Q:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOPe Domain Coordinates for d2hgjq1:

Click to download the PDB-style file with coordinates for d2hgjq1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjq1: