Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
Protein Ribosomal protein L16p [117889] (4 species) |
Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries) |
Domain d2hgjp1: 2hgj P:6-141 [145319] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to d1wkia_ |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgjp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgjp1 d.41.4.2 (P:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]} rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl piktkivrrdaydeaq
Timeline for d2hgjp1:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |