Lineage for d2hgjo1 (2hgj O:6-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852065Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2852066Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2852067Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2852068Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2852147Species Thermus thermophilus [TaxId:274] [159454] (11 PDB entries)
    Uniprot Q72I23 5-150
  8. 2852155Domain d2hgjo1: 2hgj O:6-150 [145318]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjo1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (O:) 50S ribosomal protein L15

SCOPe Domain Sequences for d2hgjo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjo1 c.12.1.1 (O:6-150) Ribosomal protein L15 (L15p) {Thermus thermophilus [TaxId: 274]}
lrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpkr
gmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplkv
vahafsksaleklkaaggepvllea

SCOPe Domain Coordinates for d2hgjo1:

Click to download the PDB-style file with coordinates for d2hgjo1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjo1: