Lineage for d2hgjn1 (2hgj N:1-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798561Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 798562Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 798563Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 798564Protein Ribosomal protein L14 [50195] (5 species)
  7. 798651Species Thermus thermophilus [TaxId:274] [141308] (9 PDB entries)
    Uniprot Q5SHP8 1-122
  8. 798659Domain d2hgjn1: 2hgj N:1-122 [145317]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
    Representative structure

Details for d2hgjn1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (N:) 50S ribosomal protein L14

SCOP Domain Sequences for d2hgjn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjn1 b.39.1.1 (N:1-122) Ribosomal protein L14 {Thermus thermophilus [TaxId: 274]}
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl

SCOP Domain Coordinates for d2hgjn1:

Click to download the PDB-style file with coordinates for d2hgjn1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjn1: