Lineage for d2hgjl1 (2hgj L:70-139)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907458Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 907459Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 907460Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 907555Species Thermus thermophilus [TaxId:274] [158350] (11 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 907570Domain d2hgjl1: 2hgj L:70-139 [145314]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
    Representative structure

Details for d2hgjl1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2hgjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjl1 a.4.7.1 (L:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag
sarsmgvevv

SCOPe Domain Coordinates for d2hgjl1:

Click to download the PDB-style file with coordinates for d2hgjl1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjl1: