Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily) alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta |
Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) |
Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein) |
Protein Ribosomal protein L9 C-domain [55655] (3 species) |
Species Thermus thermophilus [TaxId:274] [143635] (5 PDB entries) Uniprot Q5SLQ1 55-146 |
Domain d2hgjk1: 2hgj K:56-148 [145312] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |
PDB Entry: 2hgj (more details), 5 Å
SCOP Domain Sequences for d2hgjk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgjk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla lekpikelgeyvltykphpevpiqlkvsvvaqe
Timeline for d2hgjk1:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |