SCOP 1.75: Domain d2hgjh2: 2hgj H:83-171

Lineage for d2hgjh2 (2hgj H:83-171)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (11 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d2hgjh2: 2hgj H:83-171 [145311]
   Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
   automatically matched to 2J01 H:83-171

Details for d2hgjh2

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOP Domain Sequences for d2hgjh2:

Sequence; same for both SEQRES and ATOM records:

>d2hgjh2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

Timeline for d2hgjh2:

• d2hgjh2 is new in SCOP 1.75
  
• d2hgjh2 appears in SCOPe 2.01
  
• d2hgjh2 appears in the current release, SCOPe 2.08