Lineage for d2hgjg1 (2hgj G:3-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958441Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2958442Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2958443Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2958444Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2958526Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries)
  8. 2958532Domain d2hgjg1: 2hgj G:3-182 [145309]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjg1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (G:) 50S ribosomal protein L5

SCOPe Domain Sequences for d2hgjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjg1 d.77.1.1 (G:3-182) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOPe Domain Coordinates for d2hgjg1:

Click to download the PDB-style file with coordinates for d2hgjg1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjg1: