Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) |
Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
Species Thermus thermophilus [TaxId:274] [159476] (7 PDB entries) Uniprot Q5SHN9 1-208 |
Domain d2hgjf1: 2hgj F:3-208 [145308] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to 2J01 F:1-208 |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgjf1 c.22.1.1 (F:3-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]} evavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgr kiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregk lllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapegln vydivrterlvmdldawevfqnrigg
Timeline for d2hgjf1:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |