SCOP 1.75: Domain d2hgjf1: 2hgj F:3-208

Lineage for d2hgjf1 (2hgj F:3-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Thermus thermophilus [TaxId:274] [159476] (7 PDB entries)
   Uniprot Q5SHN9 1-208

8. Domain d2hgjf1: 2hgj F:3-208 [145308]
   Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
   automatically matched to 2J01 F:1-208

Details for d2hgjf1

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (F:) 50S ribosomal protein L4

SCOP Domain Sequences for d2hgjf1:

Sequence; same for both SEQRES and ATOM records:

>d2hgjf1 c.22.1.1 (F:3-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
evavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgr
kiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregk
lllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapegln
vydivrterlvmdldawevfqnrigg

Timeline for d2hgjf1:

• d2hgjf1 is new in SCOP 1.75
  
• d2hgjf1 appears in SCOPe 2.01
  
• d2hgjf1 appears in the current release, SCOPe 2.08