Lineage for d2hgjf1 (2hgj F:3-208)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101502Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 2101503Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 2101504Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 2101505Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 2101588Species Thermus thermophilus [TaxId:274] [159476] (11 PDB entries)
    Uniprot Q5SHN9 1-208
  8. 2101594Domain d2hgjf1: 2hgj F:3-208 [145308]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjf1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (F:) 50S ribosomal protein L4

SCOPe Domain Sequences for d2hgjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjf1 c.22.1.1 (F:3-208) Ribosomal protein L4 {Thermus thermophilus [TaxId: 274]}
evavyqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgr
kiwpqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregk
lllveafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapegln
vydivrterlvmdldawevfqnrigg

SCOPe Domain Coordinates for d2hgjf1:

Click to download the PDB-style file with coordinates for d2hgjf1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjf1: