Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Thermus thermophilus [TaxId:274] [159084] (5 PDB entries) Uniprot Q72I07 1-125 |
Domain d2hgjd2: 2hgj D:5-126 [145306] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to 2J01 D:2-126 |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgjd2 b.40.4.5 (D:5-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]} kfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyri idfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpdap iq
Timeline for d2hgjd2:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |