SCOP 1.75: Domain d2hgjd2: 2hgj D:5-126

Lineage for d2hgjd2 (2hgj D:5-126)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Thermus thermophilus [TaxId:274] [159084] (5 PDB entries)
   Uniprot Q72I07 1-125

8. Domain d2hgjd2: 2hgj D:5-126 [145306]
   Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
   automatically matched to 2J01 D:2-126

Details for d2hgjd2

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d2hgjd2:

Sequence; same for both SEQRES and ATOM records:

>d2hgjd2 b.40.4.5 (D:5-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
kfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyri
idfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpdap
iq

Timeline for d2hgjd2:

• d2hgjd2 is new in SCOP 1.75
  
• d2hgjd2 appears in SCOPe 2.01
  
• d2hgjd2 appears in the current release, SCOPe 2.08