Lineage for d2hgjd1 (2hgj D:127-273)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054808Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2054809Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2054888Species Thermus thermophilus [TaxId:274] [159026] (6 PDB entries)
    Uniprot Q72I07 126-272
  8. 2054892Domain d2hgjd1: 2hgj D:127-273 [145305]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgjd1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2hgjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjd1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
vgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelrkvh
gecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprgrpp
aspwgwqtkglktrkrrkpssrfiiar

SCOPe Domain Coordinates for d2hgjd1:

Click to download the PDB-style file with coordinates for d2hgjd1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjd1: