Lineage for d2hgjc1 (2hgj C:5-228)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885297Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 885298Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 885299Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 885300Protein Ribosomal protein L1 [56810] (4 species)
  7. 885311Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 885325Domain d2hgjc1: 2hgj C:5-228 [145304]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
    automatically matched to 1YL3 C:5-228

Details for d2hgjc1

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOP Domain Sequences for d2hgjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgjc1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOP Domain Coordinates for d2hgjc1:

Click to download the PDB-style file with coordinates for d2hgjc1.
(The format of our PDB-style files is described here.)

Timeline for d2hgjc1: