Lineage for d2hgj71 (2hgj 7:2-64)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1053117Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 1053118Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 1053119Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 1053120Protein Ribosomal protein L35p [143036] (3 species)
  7. 1053160Species Thermus thermophilus [TaxId:274] [160057] (5 PDB entries)
    Uniprot P80341 1-64
  8. 1053164Domain d2hgj71: 2hgj 7:2-64 [145303]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1
    automatically matched to 2J01 8:2-65

Details for d2hgj71

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (7:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2hgj71:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgj71 d.301.1.1 (7:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]}
pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
lpy

SCOPe Domain Coordinates for d2hgj71:

Click to download the PDB-style file with coordinates for d2hgj71.
(The format of our PDB-style files is described here.)

Timeline for d2hgj71: