Class j: Peptides [58231] (120 folds) |
Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) |
Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
Protein Ribosomal protein L34p [144323] (3 species) |
Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries) Uniprot P80340 1-49 |
Domain d2hgj61: 2hgj 6:1-49 [145302] Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 automatically matched to 2J01 7:1-49 |
PDB Entry: 2hgj (more details), 5 Å
SCOPe Domain Sequences for d2hgj61:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgj61 j.118.1.1 (6:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
Timeline for d2hgj61:
View in 3D Domains from other chains: (mouse over for more information) d2hgj11, d2hgj21, d2hgj31, d2hgj41, d2hgj51, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1 |