Lineage for d2hgj41 (2hgj 4:4-60)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263703Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2263704Protein Ribosomal protein L32p [144201] (3 species)
  7. 2263740Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
    Uniprot P80339 1-59
  8. 2263746Domain d2hgj41: 2hgj 4:4-60 [145300]
    Other proteins in same PDB: d2hgj11, d2hgj21, d2hgj31, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgj41

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (4:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2hgj41:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgj41 g.41.8.5 (4:4-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
hpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev

SCOPe Domain Coordinates for d2hgj41:

Click to download the PDB-style file with coordinates for d2hgj41.
(The format of our PDB-style files is described here.)

Timeline for d2hgj41: