SCOPe 2.07: Domain d2hgj21: 2hgj 2:2-60

Lineage for d2hgj21 (2hgj 2:2-60)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)

8. Domain d2hgj21: 2hgj 2:2-60 [145298]
   Other proteins in same PDB: d2hgj11, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgj21

PDB Entry: 2hgj, 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.

PDB Compounds: (2:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2hgj21:

Sequence; same for both SEQRES and ATOM records:

>d2hgj21 d.59.1.1 (2:2-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d2hgj21:

• d2hgj21 first appeared in SCOP 1.75
  
• d2hgj21 appears in SCOPe 2.06
  
• d2hgj21 appears in the current release, SCOPe 2.08