Lineage for d2hgj21 (2hgj 2:2-60)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199076Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 2199077Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 2199078Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 2199121Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
    short-chain member of the family
  7. 2199159Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)
  8. 2199165Domain d2hgj21: 2hgj 2:2-60 [145298]
    Other proteins in same PDB: d2hgj11, d2hgj31, d2hgj41, d2hgj51, d2hgj61, d2hgj71, d2hgj81, d2hgjc1, d2hgjd1, d2hgjd2, d2hgje1, d2hgjf1, d2hgjg1, d2hgjh1, d2hgjh2, d2hgjk1, d2hgjk2, d2hgjl1, d2hgjl2, d2hgjm1, d2hgjn1, d2hgjo1, d2hgjp1, d2hgjq1, d2hgjr1, d2hgjt1, d2hgju1, d2hgjv1, d2hgjw1, d2hgjx1, d2hgjy1

Details for d2hgj21

PDB Entry: 2hgj (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGJ contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGI.
PDB Compounds: (2:) 50S ribosomal protein L30

SCOPe Domain Sequences for d2hgj21:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgj21 d.59.1.1 (2:2-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
prlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

SCOPe Domain Coordinates for d2hgj21:

Click to download the PDB-style file with coordinates for d2hgj21.
(The format of our PDB-style files is described here.)

Timeline for d2hgj21: