![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (3 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
![]() | Domain d2hg5c1: 2hg5 C:22-78 [145295] automatically matched to 2H8P C:22-78 complexed with b3h, cs, goa fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2hg5 (more details), 2.75 Å
SCOPe Domain Sequences for d2hg5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg5c1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy
Timeline for d2hg5c1: