Lineage for d2hfec1 (2hfe C:22-78)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252692Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2252701Domain d2hfec1: 2hfe C:22-78 [145294]
    automatically matched to 2H8P C:22-78
    complexed with b3h, goa, rb

Details for d2hfec1

PDB Entry: 2hfe (more details), 2.25 Å

PDB Description: Rb+ complex of a K channel with an amide to ester substitution in the selectivity filter
PDB Compounds: (C:) KcsA Channel

SCOPe Domain Sequences for d2hfec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfec1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy

SCOPe Domain Coordinates for d2hfec1:

Click to download the PDB-style file with coordinates for d2hfec1.
(The format of our PDB-style files is described here.)

Timeline for d2hfec1: