Lineage for d2hd5a1 (2hd5 A:211-521)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155259Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2155266Protein Ubiquitin carboxyl-terminal hydrolase 2, USP2 [159841] (1 species)
  7. 2155267Species Human (Homo sapiens) [TaxId:9606] [159842] (2 PDB entries)
    Uniprot O75604 263-600! Uniprot O75604 264-599
  8. 2155268Domain d2hd5a1: 2hd5 A:211-521 [145293]
    Other proteins in same PDB: d2hd5b_
    complexed with zn

Details for d2hd5a1

PDB Entry: 2hd5 (more details), 1.85 Å

PDB Description: usp2 in complex with ubiquitin
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d2hd5a1:

Sequence, based on SEQRES records: (download)

>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]}
qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakliq
tiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpksn
penldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlsl
piakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlk
rfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycr
spgtgewhtfndssvtpmsssqvrtsdayllfyela

Sequence, based on observed residues (ATOM records): (download)

>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]}
qglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdgsnahtalveefakliqtiw
tsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvhlpddekgrq
mwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiavtlmdcmrlftk
edvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirtsklttfvnfplr
dldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewhtfndssvtpmsss
qvrtsdayllfyela

SCOPe Domain Coordinates for d2hd5a1:

Click to download the PDB-style file with coordinates for d2hd5a1.
(The format of our PDB-style files is described here.)

Timeline for d2hd5a1: