Lineage for d2h8pc1 (2h8p C:22-78)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456036Protein Potassium channel protein [56901] (2 species)
  7. 1456037Species Streptomyces coelicolor [TaxId:1902] [56902] (20 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1456042Domain d2h8pc1: 2h8p C:22-78 [145292]
    synthetic ligation with chain D fragment
    complexed with b3h, goa, k

Details for d2h8pc1

PDB Entry: 2h8p (more details), 2.25 Å

PDB Description: Structure of a K channel with an amide to ester substitution in the selectivity filter
PDB Compounds: (C:) KcsA Channel

SCOPe Domain Sequences for d2h8pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvgy

SCOPe Domain Coordinates for d2h8pc1:

Click to download the PDB-style file with coordinates for d2h8pc1.
(The format of our PDB-style files is described here.)

Timeline for d2h8pc1: