Lineage for d2h6jk1 (2h6j K:-6-219)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876390Species Rhodococcus erythropolis [TaxId:1833] [103313] (3 PDB entries)
  8. 876408Domain d2h6jk1: 2h6j K:-6-219 [145288]
    Other proteins in same PDB: d2h6ja1, d2h6jb1, d2h6jc1, d2h6jd1, d2h6je1, d2h6jf1, d2h6jg1
    automatically matched to 2H6J H:-6-219
    mutant

Details for d2h6jk1

PDB Entry: 2h6j (more details), 3.2 Å

PDB Description: crystal structure of the beta f145a rhodococcus proteasome
PDB Compounds: (K:) proteasome beta-type subunit 1

SCOP Domain Sequences for d2h6jk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6jk1 d.153.1.4 (K:-6-219) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
dlaphgttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaie
lvrlfavelehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldadde
sragrivsydvvggryeeragyhavgsgslaaksalkkiyspdsdeetalraaieslyda
adddsatggpdltrgiyptavtitqagavhvseettselarriva

SCOP Domain Coordinates for d2h6jk1:

Click to download the PDB-style file with coordinates for d2h6jk1.
(The format of our PDB-style files is described here.)

Timeline for d2h6jk1: