![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
![]() | Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries) Uniprot P49356 |
![]() | Domain d2h6hb1: 2h6h B:515-924 [145283] Other proteins in same PDB: d2h6ha1 complexed with acy, far, suc, zn; mutant |
PDB Entry: 2h6h (more details), 1.8 Å
SCOPe Domain Sequences for d2h6hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h6hb1 a.102.4.3 (B:515-924) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcfclsglsiaq hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
Timeline for d2h6hb1: