Lineage for d2h6hb1 (2h6h B:515-924)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743374Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1743375Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 1743376Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 1743379Domain d2h6hb1: 2h6h B:515-924 [145283]
    Other proteins in same PDB: d2h6ha1
    complexed with acy, far, suc, zn; mutant

Details for d2h6hb1

PDB Entry: 2h6h (more details), 1.8 Å

PDB Description: y365f protein farnesyltransferase mutant complexed with a farnesylated ddptasacvls peptide product at 1.8a
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2h6hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h6hb1 a.102.4.3 (B:515-924) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcfclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

SCOPe Domain Coordinates for d2h6hb1:

Click to download the PDB-style file with coordinates for d2h6hb1.
(The format of our PDB-style files is described here.)

Timeline for d2h6hb1: