SCOPe 2.01: Domain d2h64a1: 2h64 A:10-114

Lineage for d2h64a1 (2h64 A:10-114)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57517] (10 PDB entries)

8. Domain d2h64a1: 2h64 A:10-114 [145282]
   Other proteins in same PDB: d2h64b1, d2h64c_

Details for d2h64a1

PDB Entry: 2h64, 1.92 Å

PDB Description: crystal structure of a ternary ligand-receptor complex of bmp-2

PDB Compounds: (A:) Bone morphogenetic protein 2

SCOPe Domain Sequences for d2h64a1:

Sequence; same for both SEQRES and ATOM records:

>d2h64a1 g.17.1.2 (A:10-114) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]}
lkssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvns
vnskipkaccvptelsaismlyldenekvvkkdyqdmvvegcgcr

Timeline for d2h64a1:

• d2h64a1 first appeared in SCOP 1.75
  
• d2h64a1 appears in SCOPe 2.02
  
• d2h64a1 appears in the current release, SCOPe 2.08